PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0542s0040.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 195aa    MW: 22540 Da    PI: 8.8779
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0542s0040.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.61.6e-28959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krien + rqvtfskR++g+lKKA+ELSvLCda+va i+fs++gkly+++s
  Cagra.0542s0040.1.p  9 KRIENLTSRQVTFSKRKKGLLKKAHELSVLCDAQVAAIVFSQKGKLYDFAS 59
                         79***********************************************86 PP

2K-box51.83.6e-1883166992
                K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                          + e+  + l++e++ + ++i+ Lq   R+l+G+dL+s s+ eL+++  qLeksl+ +Rs+K +l  +++e+l +  ++l++e+ 
  Cagra.0542s0040.1.p  83 QREKYVQDLKKEISVMVNRIDLLQLHCRKLMGQDLDSSSVDELKEITIQLEKSLTIVRSRKAKLNEDEVEKLEEESRSLDNEKS 166
                          56788999****************999***************************************************999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.992161IPR002100Transcription factor, MADS-box
SMARTSM004322.2E-40160IPR002100Transcription factor, MADS-box
CDDcd002651.53E-37268No hitNo description
SuperFamilySSF554553.27E-30372IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-29323IPR002100Transcription factor, MADS-box
PfamPF003194.0E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-293859IPR002100Transcription factor, MADS-box
PfamPF014864.6E-1787166IPR002487Transcription factor, K-box
PROSITE profilePS5129710.78688178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MARKKIEIKR IENLTSRQVT FSKRKKGLLK KAHELSVLCD AQVAAIVFSQ KGKLYDFASS  60
NMEKMMERCE IYRREYFSAE RFQREKYVQD LKKEISVMVN RIDLLQLHCR KLMGQDLDSS  120
SVDELKEITI QLEKSLTIVR SRKAKLNEDE VEKLEEESRS LDNEKSAASC GYGNMNTSDV  180
ETDLFIGLPQ SRML*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-19166166Myocyte-specific enhancer factor 2B
1tqe_Q3e-19166166Myocyte-specific enhancer factor 2B
1tqe_R3e-19166166Myocyte-specific enhancer factor 2B
1tqe_S3e-19166166Myocyte-specific enhancer factor 2B
3mu6_A2e-19272171Myocyte-specific enhancer factor 2A
3mu6_B2e-19272171Myocyte-specific enhancer factor 2A
3mu6_C2e-19272171Myocyte-specific enhancer factor 2A
3mu6_D2e-19272171Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006281451.11e-126hypothetical protein CARUB_v10027529mg
SwissprotQ9LT934e-75AGL71_ARATH; MADS-box protein AGL71
TrEMBLR0GCF91e-126R0GCF9_9BRAS; Uncharacterized protein
STRINGBra012957.1-P1e-93(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88051235
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51870.16e-72AGAMOUS-like 71